PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun003852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 243aa    MW: 27732.4 Da    PI: 4.6735
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-4459PU_refplantGDBView CDS
gnl|UG|Vun#S45809884PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-183889556
               SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               ++f+++q++ Le++Fe ++ +  +++ +LA+ lgL+ rqV +WFqN+Ra++k
  Vun003852 38 RRFSDDQIKSLETMFETESRLEPRKKLQLARDLGLQPRQVAIWFQNKRARWK 89
               48*************************************************9 PP

2HD-ZIP_I/II1192.6e-3837127393
  HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   rr+s++q+k+LE++Fe+e++Lep++K +lar+Lglqprqva+WFqn+RAR+k+kqlE+dy  L+++y++l+++ e+L+ke+++L  +l++
    Vun003852  37 TRRFSDDQIKSLETMFETESRLEPRKKLQLARDLGLQPRQVAIWFQNKRARWKSKQLERDYGILQSNYNSLASRFEALKKEKQTLLIQLQK 127
                  79***********************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.15E-181593IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-191891IPR009057Homeodomain-like
PROSITE profilePS5007116.9573191IPR001356Homeobox domain
SMARTSM003893.5E-153495IPR001356Homeobox domain
PfamPF000464.5E-163889IPR001356Homeobox domain
CDDcd000865.93E-143892No hitNo description
PRINTSPR000311.8E-56271IPR000047Helix-turn-helix motif
PROSITE patternPS0002706689IPR017970Homeobox, conserved site
PRINTSPR000311.8E-57187IPR000047Helix-turn-helix motif
PfamPF021831.7E-1691133IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEYTYSAEGA ETETYTSSST TPSSAMRSSK KKANNNTRRF SDDQIKSLET MFETESRLEP  60
RKKLQLARDL GLQPRQVAIW FQNKRARWKS KQLERDYGIL QSNYNSLASR FEALKKEKQT  120
LLIQLQKLNH LMQKPLEGGQ SRTQVEAANS MDSESENGGT MKCEEEEKPS PSVERSEHVH  180
GVLSDDDGSI KVEDFGLEDE HGLLNFGEHA DDSLTSPEDW SAFESDGLLG QTTGDYQWWD  240
FWS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135294.11e-154hypothetical protein PHAVU_010G117200g
RefseqXP_014524102.11e-155PREDICTED: homeobox-leucine zipper protein ATHB-12
SwissprotP468977e-66ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLA0A0L9VQF41e-158A0A0L9VQF4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SZ301e-158A0A0S3SZ30_PHAAN; Uncharacterized protein
STRINGGLYMA16G02390.11e-146(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.14e-66homeobox 7